HORDB

ID: hor005689
Uniprot ID: Q9PTA0
Protein name: C-flanking peptide of NPY
Gene name: npy
Organism: Dicentrarchus labrax (European seabass) (Morone labrax)
Family: NPY Family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Dicentrarchus (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031841 neuropeptide Y receptor binding; GO:0031843 type 2 neuropeptide Y receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0045938 positive regulation of circadian sleep/wake cycle, sleep; GO:0071878 negative regulation of adenylate cyclase-activating adrenergic receptor signaling pathway; GO:2000253 positive regulation of feeding behavior
GO CC: GO:0005576 extracellular region

Sequence: SSPEILDTLVSELLLKESTDQLPQSRYDPSLW
Length: 32
Propeptide: MHPNLVSWLGTLGFLLWALLCLGALTEGYPVKPENPGEDAPAEELAKYYSALRHYINLITRQRYGKRSSPEILDTLVSELLLKESTDQLPQSRYDPSLW
Signal peptide: MHPNLVSWLGTLGFLLWALLCLGALTEG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005689_AF2.pdb

hor005689_ESM.pdb

Mass:	421419	Formula:	C163H259N39O56
Absent amino acids:	ACFGHMN	Common amino acids:	L
pI:	3.82	Basic residues:	2
Polar residues:	9	Hydrophobic residues:	10
Hydrophobicity:	-44.69	Boman Index:	-5809
Half-Life:	1.9 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	106.56
Instability Index:	10184.38	Extinction Coefficient cystines:	6990
Absorbance 280nm:	225.48